PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007704P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 320aa    MW: 34601.1 Da    PI: 8.3911
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007704P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.7e-392281362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    ++ lkcprCds ntkfCyynnysl+qPryfCk+CrryWtkGGalrnvPvGgg+rknkk +
  MELO3C007704P1 22 QHPLKCPRCDSPNTKFCYYNNYSLTQPRYFCKTCRRYWTKGGALRNVPVGGGCRKNKKLK 81
                    6789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-252277IPR003851Zinc finger, Dof-type
PfamPF027014.4E-332379IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3572579IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MLPEKLSSGG SRHPKPISDH NQHPLKCPRC DSPNTKFCYY NNYSLTQPRY FCKTCRRYWT  60
KGGALRNVPV GGGCRKNKKL KSSSSSSSLR LPSSSKDDSG SSNLEIGRLG FFVNGFSSGQ  120
LSGSRNSSFS SAPSMGLYDQ FGGFSLDQSR SLNNSFIPST GFVNSLNVDT SLASSIESLS  180
SMNQDLHWKL QQQRLAMLFG SGHNNTAIDK NRGVSSPIAF EDHGQELNPG SFRNLEISKP  240
EACNNSSDFS NARKETVVIA GARAGGESAV ADEWFFGDSY TAPSMTTGTA AAGYNSGDSA  300
ARCDDVQEWH DLHPYTHLP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440523.10.0PREDICTED: dof zinc finger protein DOF5.7
TrEMBLA0A0A0KJW60.0A0A0A0KJW6_CUCSA; Uncharacterized protein
STRINGVIT_00s0218g00040.t013e-72(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.14e-33Dof family protein